bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2626_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value 227882.SAV943 87.0 2e-16 > 227882.SAV943 Length=4881 Score = 87.0 bits (214), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 5/127 (3%) Query 1 LRNSLSSTLGIKLPATAMFDYPTVGAMIGYVNKTIAEQFSGHNLGGLSSGFGKVSKTERR 60 LRN L++ G+ LP T +FDYPT A+ GY+ + + E G +V E Sbjct 1534 LRNRLNAVTGLLLPTTLIFDYPTPSALAGYLKEQLEEGAGGQRDIAPPVPASRVDVDE-- 1591 Query 61 VGAIAIVGAACHMPGGSTTTARFWEMLQAGTDCMDEIPLDR-WNMFAFYNRDPDHPDTTY 119 IAIVG AC PGG + WE++ +G D + E P+DR W++ AFY+ +P ++Y Sbjct 1592 --PIAIVGMACRFPGGVESAEDLWELVASGRDAVGEFPVDRGWDVEAFYDPEPGRAGSSY 1649 Query 120 AKLGAMV 126 + G + Sbjct 1650 TRRGGFL 1656 Lambda K H 0.320 0.135 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40