bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2622_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL009383-PA 70.9 1e-11 > 7159.AAEL009383-PA Length=691 Score = 70.9 bits (172), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 43/110 (39%), Positives = 63/110 (57%), Gaps = 6/110 (5%) Query 1 GALDRARALYERLLDKTQHVNAFKGYATFEWKKAEQKDR-----ARQVLNRGLDVCKANG 55 G D AR LYERLL++T HV + +A FE AE +D +R+V R D K Sbjct 524 GEFDLARQLYERLLERTTHVKVWISFAKFE-MAAENEDNVNVQLSRRVYERANDSLKNAV 582 Query 56 WDEDRAALLEHWLALEREGGDAQAIQRVFRLLPKKIKKRKTQKNANGVEE 105 E R +LE W E+E GD +++++V +P+K+KKR+ + +GVEE Sbjct 583 EKETRVLILEAWRDFEKEHGDEESLRKVMAKMPRKVKKRQKIISESGVEE 632 Lambda K H 0.317 0.132 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40