bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2614_orf2 Length=142 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0206512 103 2e-21 > 44689.DDBDRAFT_0206512 Length=1036 Score = 103 bits (256), Expect = 2e-21, Method: Composition-based stats. Identities = 59/134 (44%), Positives = 80/134 (59%), Gaps = 4/134 (2%) Query 2 FYKEYVKAILERIRENANLEFEAIWREAKRTGLRCCDLTDILSQKIIELKTDISKSNCLW 61 FY+ Y+K + I NA LEFE IW E + T L+D+LS KI L I S+ LW Sbjct 907 FYENYIKDVHHTIESNARLEFECIWSEHESTKTPRSILSDLLSNKINSLNDSIQTSS-LW 965 Query 62 ADEGLVNYVLSSAVPDVLVPQLLSVEVFRKRVPEAYQQAIFTSFLSSRFFYGQPFTANVS 121 D+ L ++S+A P VL+ LL V+ +RVPE Y +AIF S+L+SRF Y + N + Sbjct 966 TDQSLRRKIISAACPKVLL-NLLGVDKIMERVPEPYVKAIFGSYLASRFVY--KYGLNSN 1022 Query 122 AFAFIAYLEELKQK 135 FAF Y+E LKQ+ Sbjct 1023 EFAFYTYMETLKQQ 1036 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22741008115 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40