bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2578_orf1 Length=85 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.8 62.8 3e-09 > 5833.MAL8P1.8 Length=438 Score = 62.8 bits (151), Expect = 3e-09, Method: Composition-based stats. Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 20/102 (19%) Query 4 TSAPQTAYKTTESRTRTSYSVML---------EEAQT-----------PGVMSVELLACA 43 ++ Q YK T S RTS +V L EE Q ++ +E C Sbjct 144 SNEKQEQYKLTNSINRTSSTVFLYTLRSRSVIEENQIDEDSSIVYTKDENIIELENTICN 203 Query 44 LAQLPLQHLESLVLVRYAEGEYFSEHHDGGFRPKTVLLYLND 85 L ++PL +LE L +V+Y + YF+ HHDG FR T+L+YLND Sbjct 204 LVKIPLCYLEPLAIVKYEKNNYFNLHHDGSFRRATLLIYLND 245 Lambda K H 0.315 0.128 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22515314785 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40