bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2568_orf1 Length=180 Score E Sequences producing significant alignments: (Bits) Value 5833.PF10_0224 249 2e-65 > 5833.PF10_0224 Length=5687 Score = 249 bits (637), Expect = 2e-65, Method: Composition-based stats. Identities = 105/180 (58%), Positives = 145/180 (80%), Gaps = 1/180 (0%) Query 1 QDVVAMQKLDLAHKEGHWVLLQNIHLMPRWTVELEKKLDAFSSEGPHPNFRCFLSSELCD 60 Q+ +A+ KL+L+HKEGHW++L+NIHLM ++ + LE +D +++EG HPNFRCFL+SE+ Sbjct 5129 QESIALSKLELSHKEGHWIVLENIHLMAKFNLILENVIDKYATEGSHPNFRCFLTSEITT 5188 Query 61 YIPVGILDRSIKLTNEPPQGLQANLKRAFACFPKDDFDEKDQKVKAIIFGLCFFHAVLLE 120 IP+ IL+RSIKLTNE P G + NLKRAF F DD++EKD + K I+F LC+FH++++E Sbjct 5189 NIPISILERSIKLTNEAPTGFKENLKRAFTFFSPDDYEEKDLRTKNILFSLCYFHSIIVE 5248 Query 121 RKRFGPRGWNMNYPFAMGDLRDSAMVLFNYMEQQQGGSKVPWDDLKYIFGEIMYGGHIID 180 R +FG +G+N+ YPF++ DLRDSA VLFNY++ Q KVPW+DLKYIFGEIMYGGHI++ Sbjct 5249 RAKFGSQGFNIKYPFSLSDLRDSAKVLFNYLDNQN-SIKVPWNDLKYIFGEIMYGGHIVN 5307 Lambda K H 0.325 0.143 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37047630060 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40