bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2566_orf2 Length=133 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000019687 120 2e-26 > 13616.ENSMODP00000019687 Length=252 Score = 120 bits (300), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 56/130 (43%), Positives = 85/130 (65%), Gaps = 3/130 (2%) Query 4 LYGCLLGLRRHQLRDFCADFFDAIGCKKYMHTLVKSYSGGTKRKLSLGIAMLGEVDLLLL 63 +Y + G+ Q++ + A+ + + LVK YSGG KRKLS GIA+LG+ ++ L Sbjct 26 MYARIWGIPEQQIQSYVAEIIFDLLLETQADRLVKDYSGGNKRKLSAGIALLGKPKIIFL 85 Query 64 DEPTSGVDPESRQVLWRMIEEAKNSQTSGKAIVLTSHSMEECEVLGDRVGIIHKGKMLCL 123 DEP++G+DP +R++LW + A+ +GKAI++TSHSMEECE L R+ I+ G+ CL Sbjct 86 DEPSTGMDPVARRLLWNQVTRARE---AGKAIIITSHSMEECEALCTRLAIMVNGRFKCL 142 Query 124 GTPAELRSAY 133 G+P L+S Y Sbjct 143 GSPQHLKSKY 152 Lambda K H 0.322 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22766716098 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40