bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2500_orf1 Length=115 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00016817001 66.2 3e-10 > 99883.GSTENP00016817001 Length=173 Score = 66.2 bits (160), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 40/84 (47%), Positives = 53/84 (63%), Gaps = 7/84 (8%) Query 32 PAVGPAHFGDRRSDEGLELLACIVEGTYGNTIWRVWKARDSKRDVIVALKQMRLLPKQSH 91 P + FG RS E L I EGTYG V++ARD+K D IVALK++R+ ++ Sbjct 84 PFLHFPQFGSCRSVREFERLNRIGEGTYGI----VYRARDTKSDEIVALKKVRMDKEK-- 137 Query 92 LEGLPRGALREITLLQRLQHPNIV 115 +G+P +LREI LL RL+HPNIV Sbjct 138 -DGIPISSLREINLLLRLRHPNIV 160 Lambda K H 0.321 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22698934816 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40