bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2499_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value 4896.SPAC959.03c 70.5 2e-11 > 4896.SPAC959.03c Length=520 Score = 70.5 bits (171), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 39/92 (42%), Positives = 56/92 (60%), Gaps = 1/92 (1%) Query 2 KRSRAIIKQHKTLAAKTKESAAAVSSLFEEQGGYIEAEGLEKVYKFRQEDILKNVSEEIR 61 K+ R+ I++ + + S A L E+ G +EAEGLE+ YKFRQ+ + NV+ E Sbjct 32 KKLRSNIQKIEERIENVESSLAKTEILHEDNPGLLEAEGLERTYKFRQDQLAPNVALETA 91 Query 62 KKAFRLNLS-YGPYSISCSRDGRYLLLGGDKG 92 K+F L+L +G YS +RDGR +LLGG KG Sbjct 92 TKSFSLDLDKFGGYSFDYTRDGRMILLGGRKG 123 Lambda K H 0.313 0.132 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22844715270 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40