bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2480_orf1 Length=88 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G50670.1 65.1 5e-10 > 3702.AT3G50670.1 Length=427 Score = 65.1 bits (157), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 44/94 (46%), Positives = 56/94 (59%), Gaps = 12/94 (12%) Query 1 KIDGRRVLVDVERARTVPGWLPRRLGGGRGQPRG------AGKNQPDISSLVAQISAPPP 54 KIDGRRVLVDVER RTVP W PRRLGGG G R G+ QP +Q P Sbjct 203 KIDGRRVLVDVERGRTVPNWRPRRLGGGLGTSRVGGGEEIVGEQQP--QGRTSQSEEPSR 260 Query 55 SSDSKDKTRDRDRDRERDR----ERDRDRERDTP 84 + ++K+R++ ++RER R E+ R+R RD P Sbjct 261 PREEREKSREKGKERERSRELSHEQPRERSRDRP 294 Lambda K H 0.313 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23142708390 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40