bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2456_orf2 Length=132 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.234 144 7e-34 > 5833.MAL13P1.234 Length=5987 Score = 144 bits (363), Expect = 7e-34, Method: Composition-based stats. Identities = 68/116 (58%), Positives = 92/116 (79%), Gaps = 1/116 (0%) Query 2 KTFVASLQERYTYHLLNSVFSSLGQSSLLNLPRMPFELGKNTIGLAANAVDSVSAGLGSL 61 K+F A L+++Y++ +L + +G SSL+N+P++P E+G+NTIGLA AVD+VS G+GS Sbjct 5659 KSFYALLKDKYSHSILACLGFIVGYSSLINIPKIPLEIGRNTIGLAVYAVDNVSVGIGSF 5718 Query 62 LSTFTFDSEYINRRQRERV-RNTASMRDGFLSAGKNIGEGVWSLTNIVTKPIEGAQ 116 LS TFDSEYINRRQ+ER + +M++G +SA KNIGEGV SL+NIVTKPIEGAQ Sbjct 5719 LSNLTFDSEYINRRQKERTFKTNTNMKEGLISAVKNIGEGVLSLSNIVTKPIEGAQ 5774 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851147482 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40