bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2356_orf1 Length=80 Score E Sequences producing significant alignments: (Bits) Value 314315.LSA1040 78.6 5e-14 > 314315.LSA1040 Length=864 Score = 78.6 bits (192), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%) Query 24 QQQAVKAVADALAIQRAGLSPKNKPLGTFMFLGSSGVGKTELAKAVAEEMFDSEKNL 80 Q QAV AV DA+ RAGL N+PLG+F+FLG +GVGKTELAKA+AE++FDSE+++ Sbjct 574 QDQAVDAVTDAVLRARAGLQDPNRPLGSFLFLGPTGVGKTELAKALAEDLFDSERHM 630 Lambda K H 0.312 0.127 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22875389805 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40