bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2339_orf1 Length=158 Score E Sequences producing significant alignments: (Bits) Value 28985.KLLA0F12892g 184 7e-46 > 28985.KLLA0F12892g Length=775 Score = 184 bits (467), Expect = 7e-46, Method: Compositional matrix adjust. Identities = 81/153 (52%), Positives = 112/153 (73%), Gaps = 0/153 (0%) Query 1 ISQPSCVILAITAANTDIANSDSLKIARDADPEGIRTIGVVTKVDTMEEGCDCADVLLGK 60 +++P+C+ILAI+ AN D+ NS+SLK+AR+ DP G RTIGV+TK+D M++G + D+L GK Sbjct 210 VAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLMDQGTNALDILSGK 269 Query 61 VYPLRRGFVGVVCRSLAQTREQLSPRAAQEEETKFFQSHPAYRSLGNRCGTRYLARMLNQ 120 +YPL+ GFVGVV RS ++ S A E +FF HP YR++ RCGTRYLA++LNQ Sbjct 270 LYPLKLGFVGVVNRSQQDIQQNKSVEEALNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQ 329 Query 121 VLMQHIRESLPELRERLQKRLQEAEAELAGYGD 153 VLM HIR+ LP+++ RL + + E ELA YGD Sbjct 330 VLMNHIRDKLPDIKARLNTLIGQTEQELATYGD 362 Lambda K H 0.319 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 25621323489 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40