bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2336_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value 283942.IL1277 95.5 4e-19 > 283942.IL1277 Length=863 Score = 95.5 bits (236), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 41/93 (44%), Positives = 61/93 (65%), Gaps = 0/93 (0%) Query 8 VERVLSLQQHDAFTFKNPNRLRSLFTAFVYNRPHFHRKDAKGYQVVADAVLKVDSFNPQA 67 VERV L H F+ KNPNR+ SL AF N+ FH+ D GY+++ + ++++ NPQ Sbjct 755 VERVKDLMTHPDFSLKNPNRVYSLLAAFTQNQAQFHKADGAGYELIGSVIQQLNTSNPQV 814 Query 68 AARLAGAFLPWQRYDKHRQQQMKEQLIRIRDTP 100 A+RL AF+ W+RYD++RQ+ M+ QL +R P Sbjct 815 ASRLLSAFVSWRRYDENRQKLMRNQLESLRQLP 847 Lambda K H 0.324 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23067334887 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40