bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2287_orf1 Length=164 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP005366-PA 115 5e-25 > 7165.AGAP005366-PA Length=1364 Score = 115 bits (288), Expect = 5e-25, Method: Compositional matrix adjust. Identities = 56/139 (40%), Positives = 90/139 (64%), Gaps = 12/139 (8%) Query 24 FYKGTSKDQTPFFKDKDSQLIAQRKWPAIFEQEVDMSKVNVEVMKAWINHKITELLGFED 83 + GT++ Q F DK+ +L+ Q K+ + VDMSKV ++V++ WI+ KIT++L ED Sbjct 2 MFTGTNQQQDSRFSDKEKKLLKQMKFSDNLNKRVDMSKVKLDVLRPWISQKITDMLNIED 61 Query 84 DIVISYCLSQLVPEEALAADVDERKNYLCPKKLAISLTGFV-GKQATHFVRELWKLLLSA 142 D+++ + +QL E + + CPKK+ I+LTGF+ GK A F+ +LW LLLSA Sbjct 62 DVIVEFVYNQL-----------EEEKFPCPKKMQINLTGFLNGKNARLFMEDLWSLLLSA 110 Query 143 QNTPTGIPPEFLENRRLEM 161 Q++ TGIP EF++ ++ E+ Sbjct 111 QDSDTGIPEEFIQAKKEEI 129 Lambda K H 0.318 0.133 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40