bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2219_orf1 Length=110 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP001297-PA 68.2 7e-11 > 7165.AGAP001297-PA Length=379 Score = 68.2 bits (165), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 40/110 (36%), Positives = 61/110 (55%), Gaps = 8/110 (7%) Query 2 ARGAAVAIFNPISIVKTRMES-SLGSGGMSQAFLQLLRNERPLDWFRGTFATICRDFPFS 60 AR AV I NP+ +++T+M+S L + QAF +LR + L ++G F TI RD PFS Sbjct 172 ARVLAVTIVNPLELIRTKMQSEKLSYREVGQAFRSMLRVQGILGLWKGFFPTILRDVPFS 231 Query 61 GLFFVVYVNLKSHMGVEADSRERVSCYALQNFGCGAVAAATASAITHPFD 110 G+++ Y + K H V + +A +F GA++ A+ T PFD Sbjct 232 GIYWTTYESFKKHFNVSQPT------FAF-SFAGGAISGGVAAFFTVPFD 274 Lambda K H 0.326 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40