bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2211_orf1 Length=115 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb11.02.1040 125 4e-28 > 5691.Tb11.02.1040 Length=290 Score = 125 bits (314), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 56/97 (57%), Positives = 76/97 (78%), Gaps = 0/97 (0%) Query 18 KEGPLVVIVTGMAGSGKSTLVKAMNDQLVSEGLKTYIINLDPAVLQLPYSSNIDIQDSVD 77 K PLV++V GMAG+GK+TLV + +G KTY INLDPAV +PY +NIDI+D+V+ Sbjct 4 KPKPLVILVVGMAGTGKTTLVHRLQHYAEEKGKKTYFINLDPAVADVPYGANIDIRDTVN 63 Query 78 YKKIMQYYRLGPNGAILTSLNLFATRFGDLLKILQNK 114 YK++++ YRLGPNGAI+TSLNLFAT+F ++ IL+ K Sbjct 64 YKEVIKQYRLGPNGAIMTSLNLFATKFHQVIGILEKK 100 Lambda K H 0.318 0.135 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22698934816 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40