bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2203_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000015558 168 3e-41 > 7719.ENSCINP00000015558 Length=261 Score = 168 bits (426), Expect = 3e-41, Method: Compositional matrix adjust. Identities = 76/124 (61%), Positives = 103/124 (83%), Gaps = 0/124 (0%) Query 2 ISKLPKAVPVLVTHDARTIRFPHPNIKVHDTIRVNIADSKILDTYKFEVGNLAMITGGHN 61 ++ PK VP LVTHDARTIR+P+P+IKVHDT+ V+IA KI + GN+ MITGGHN Sbjct 131 VATAPKGVPYLVTHDARTIRYPNPDIKVHDTVVVDIASGKITGFVHLDSGNMCMITGGHN 190 Query 62 VGRVGTIVNRDRHLGSFDIVHIRDARGNEFATRINNVFVIGKGDKPMVSLPKDKGIRLSI 121 +GRVGT+++R+RH GSFDI+H++DA G+ FATR++NVF+IG+ +KPMVSLP+ KGI+L+I Sbjct 191 LGRVGTVMHRERHPGSFDIIHVKDALGHTFATRLSNVFIIGQANKPMVSLPRGKGIKLTI 250 Query 122 FEDR 125 E+R Sbjct 251 AEER 254 Lambda K H 0.323 0.142 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40