bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2164_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 7227.CG1263-PB 176 2e-43 > 7227.CG1263-PB Length=256 Score = 176 bits (445), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 77/122 (63%), Positives = 104/122 (85%), Gaps = 0/122 (0%) Query 1 APLAVVSFRDAYPYRINKERMLAVEGLHTGQFIHCGKKAALCIGNVLPLGRVPEGTVVCA 60 APLAVV FRD Y Y+I KE +A EG+HTGQF++CG+KA L IGNV+PL ++PEGT++C Sbjct 56 APLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICN 115 Query 61 VEEKAGDRGTLAKTSGSFATVVGHSEETGKSRVRLPSGARKTLPSSARCIIGLVAGGGRI 120 +EEK GDRG LA+TSG++ATV+ H+++T K+RV+LPSGA+K +PS+ R ++G+VAGGGRI Sbjct 116 LEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRI 175 Query 121 DK 122 DK Sbjct 176 DK 177 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40