bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2155_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL2415w 201 4e-51 > 5833.PFL2415w Length=297 Score = 201 bits (512), Expect = 4e-51, Method: Compositional matrix adjust. Identities = 95/131 (72%), Positives = 117/131 (89%), Gaps = 0/131 (0%) Query 1 RSSTYDFFSITKDLDPPGVLVESKKYKFKFNAVDKTHETYSGINVRLRYFVRLTIHRHYA 60 ++++YDFFSI+KDL+PPG LVESK++K+KF+AVDK HE+Y G NV+LRYFVRL I + Y+ Sbjct 78 KANSYDFFSISKDLEPPGFLVESKQFKWKFSAVDKQHESYFGTNVQLRYFVRLNIIKGYS 137 Query 61 SSIVKEHDFIVQNVGPPPEIKNSIKMEVGIEDCLHIEFEFDKSRYHLKDVVIGKVYFVLV 120 +I KE DFIVQN+ PPEI N+IKMEVGIEDCLHIEFE+DKS+YHLKDVV+GKVYF+LV Sbjct 138 GNIQKEIDFIVQNLCIPPEINNTIKMEVGIEDCLHIEFEYDKSKYHLKDVVVGKVYFLLV 197 Query 121 RIKIKDMQLDI 131 RIKIK M+LDI Sbjct 198 RIKIKHMELDI 208 Lambda K H 0.324 0.142 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40