bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2086_orf1 Length=151 Score E Sequences producing significant alignments: (Bits) Value 5671.LinJ36.5000 93.6 2e-18 > 5671.LinJ36.5000 Length=965 Score = 93.6 bits (231), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 40/94 (42%), Positives = 66/94 (70%), Gaps = 0/94 (0%) Query 41 SISEFSASLSQRERHRLLRKFKEGQVEVLVCSDVAARGLGVSGVQTVLHYDAPQTPQAYI 100 +++ AS+ QR+R + + KFK+G++ VLV +DVA+RGL + G++ V+HY P+T +AYI Sbjct 731 AVAGLHASMQQRQRLKFIDKFKQGKIHVLVATDVASRGLDIDGLKYVVHYQVPRTTEAYI 790 Query 101 HRAGRSARARREGLSICLFTGEEFIRFKQKDKTL 134 HR GR+AR GLS+ L +E + F++ ++L Sbjct 791 HRCGRTARCGGTGLSVLLVNAQEHMSFRKLMESL 824 Lambda K H 0.312 0.125 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22675567716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40