bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2067_orf2 Length=123 Score E Sequences producing significant alignments: (Bits) Value 391009.Tmel_0413 128 5e-29 > 391009.Tmel_0413 Length=789 Score = 128 bits (321), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 60/113 (53%), Positives = 80/113 (70%), Gaps = 0/113 (0%) Query 1 DVILFVDEIHTLVGAGKTSGSSDATQILKVPLARGGIVLVGATTLEEYKLHIEKDAAFCR 60 +VILF+DE+HT+VGAG G+ DA+ +LK LARG + +GATTLEEY+ HIEKD A R Sbjct 266 NVILFIDELHTIVGAGAAEGAMDASNMLKPALARGELHAIGATTLEEYRKHIEKDKALAR 325 Query 61 RFQNIVVEAPSKERALSILKKVKTNYEKFHSVDLSDEVLEGIVALSDQYVKQR 113 RFQ + VE PS E + ILK +K YEK H+V ++DE +E LS +Y++ R Sbjct 326 RFQPVFVEEPSVEETIRILKGLKETYEKHHNVKITDEAIEAAAKLSSKYIQDR 378 Lambda K H 0.316 0.135 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40