bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2065_orf1 Length=97 Score E Sequences producing significant alignments: (Bits) Value 8364.ENSXETP00000028932 90.5 1e-17 > 8364.ENSXETP00000028932 Length=492 Score = 90.5 bits (223), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 47/97 (48%), Positives = 62/97 (63%), Gaps = 8/97 (8%) Query 1 GTIALSNVGVISGTYIHPLLFDGQAVIVGVGRVRQLPRFVSCDDAAGEGSSALVARDIIN 60 GT LSN+G I GTY P++ + I +G+V+ LPRF D+ G+ +V IIN Sbjct 404 GTFTLSNIGSIGGTYAKPVILPPEVAIGAIGKVQVLPRF----DSKGQ----VVKAQIIN 455 Query 61 CSFSADHRHCDGATITRFSKSIKTLLENPEMMLLHLK 97 S+SADHR DGAT++RFS K+ LENP +MLL LK Sbjct 456 ISWSADHRIIDGATMSRFSNLWKSYLENPSLMLLELK 492 Lambda K H 0.324 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22472223870 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40