bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2064_orf1 Length=159 Score E Sequences producing significant alignments: (Bits) Value 240292.Ava_2775 62.8 4e-09 > 240292.Ava_2775 Length=250 Score = 62.8 bits (151), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 43/119 (36%), Positives = 68/119 (57%), Gaps = 5/119 (4%) Query 44 SPATYVLTYIVAGLL-IPAPLLSVLAGVLMGPSPLAVVVILCGSLGSACLAFAISRFLLR 102 P Y++ Y +A LL IP +L++ +G L G +V V++ + G A LAF I R+L R Sbjct 52 GPIAYIIIYNLATLLFIPGSILTLKSGCLFGVFWGSVYVLIAATTG-AILAFIIGRYLSR 110 Query 103 QFVVRRFVRRSQQLQAIELALQKDSVKLVLCTRV--ILPFTFNNYFLGTTPISATTFAL 159 +VVR+ + + + + I+ A+ K+ K+VL TR+ + PF NY G T IS + L Sbjct 111 DWVVRQ-IDKYPKFKMIDQAVAKEGWKIVLLTRLSPVFPFNLLNYAFGITCISLKDYIL 168 Lambda K H 0.330 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40