bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2052_orf2 Length=106 Score E Sequences producing significant alignments: (Bits) Value 9598.ENSPTRP00000030825 95.9 3e-19 > 9598.ENSPTRP00000030825 Length=156 Score = 95.9 bits (237), Expect = 3e-19, Method: Compositional matrix adjust. Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 0/96 (0%) Query 7 TAPSNEEARAIAEHLVTQHLAACVQIVPAVESIYEWKGTIEKSSEVLIIIKTQRAHTQAV 66 T P+ + AR IA +V + LAACV ++P + SIYEWKG IE+ SEVL++IKTQ + A+ Sbjct 51 TCPNEKVAREIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPAL 110 Query 67 VQAIKDMHSYEVPEVVFTDIVDGNADYIKWARAVTQ 102 ++ +H YEV EV+ + GN Y++W R VT+ Sbjct 111 TDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTE 146 Lambda K H 0.316 0.128 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22605445551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40