bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2030_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000003584 174 5e-43 > 8090.ENSORLP00000003584 Length=486 Score = 174 bits (442), Expect = 5e-43, Method: Compositional matrix adjust. Identities = 79/127 (62%), Positives = 99/127 (77%), Gaps = 0/127 (0%) Query 2 QEEVRHWLMPKEGVVHVYVREQGGKVTDLISFYELPSSVIGNQKHKEVKAAYSFYNVGTS 61 QEEV HW +P+E +V Y+ E GKVTD +SFY LPS+++ + H+ +KAAYSFYNV T+ Sbjct 359 QEEVEHWFLPQENIVDTYLVESNGKVTDFLSFYTLPSTIMNHPVHRSLKAAYSFYNVHTT 418 Query 62 APLKELIQDALCLAKQKDFDVFNALDVMENKTFVEDLKFGIGDGFLRYYLYNWRCPQVLH 121 PL +L+ DAL LAK K FDVFNALD+MENKTF+E LKFGIGDG L+YYLYNW+CP + Sbjct 419 TPLLDLMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGP 478 Query 122 NDIGLVL 128 +GLVL Sbjct 479 EKVGLVL 485 Lambda K H 0.322 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40