bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2010_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 6239.W09C2.3a 67.8 9e-11 > 6239.W09C2.3a Length=1252 Score = 67.8 bits (164), Expect = 9e-11, Method: Composition-based stats. Identities = 43/102 (42%), Positives = 55/102 (53%), Gaps = 2/102 (1%) Query 8 GADYAETRRLKGSDSLIAHREEFSSDRK-MMTTVVYREECGGSHMRVYVKGAAERVLQLC 66 G DYA R+ K + + F+S RK MMT V Y E RVY KGA+E VL C Sbjct 564 GGDYAAIRK-KFPEHDLTKVYTFNSSRKCMMTVVPYAENGQNIGYRVYCKGASEIVLGRC 622 Query 67 NGLMTASGQIQKLQPERKKGIEDRIIDGMAREALRTICIAYR 108 L+ + G+ +L +R K I II MA LRTIC+AY+ Sbjct 623 TYLIGSDGKPHQLTGDRLKEITSTIIHEMANSGLRTICVAYK 664 Lambda K H 0.321 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40