bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_2001_orf2 Length=137 Score E Sequences producing significant alignments: (Bits) Value 224308.BSU17330 82.8 3e-15 > 224308.BSU17330 Length=314 Score = 82.8 bits (203), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 37/74 (50%), Positives = 48/74 (64%), Gaps = 5/74 (6%) Query 64 TPPKVVFIIGPTGVGKSRLGLDICLELRKNGINAEIVSADSMQVYKGCDIATAKASAAER 123 T VV ++GPT VGK+ L + + +NAEI+S DSMQ+YKG DI TAK + E Sbjct 4 TKQPVVILVGPTAVGKTNLSIQLA-----KSLNAEIISGDSMQIYKGMDIGTAKITEQEM 58 Query 124 EAVPHHLLDVCTPQ 137 E VPHHL+D+ PQ Sbjct 59 EGVPHHLIDILDPQ 72 Lambda K H 0.317 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40