bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1979_orf1 Length=163 Score E Sequences producing significant alignments: (Bits) Value 4952.YALI0F24387g 73.6 2e-12 > 4952.YALI0F24387g Length=428 Score = 73.6 bits (179), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 5/62 (8%) Query 75 SSSPAARLCFSRGLAVGTFERLKPHLNIGTIGHVDHGKTTLTAAITKVLATSSKVRGALW 134 +S + ++ F+RG A F+R KPH+NIGTIGHVDHGKTTLTAAITKVLA GA + Sbjct 18 TSVASNKVLFARGYA--AFDRSKPHVNIGTIGHVDHGKTTLTAAITKVLAEKG---GAKF 72 Query 135 LD 136 LD Sbjct 73 LD 74 Lambda K H 0.320 0.129 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28009217385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40