bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1970_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1145w 114 6e-25 > 5833.PFI1145w Length=821 Score = 114 bits (286), Expect = 6e-25, Method: Composition-based stats. Identities = 57/142 (40%), Positives = 86/142 (60%), Gaps = 9/142 (6%) Query 6 GVGYDIVRGNPLGDPNLMGDPGLRSPVIRFSYSQDEEGVSSDLRELQPRGAYSRPFVACK 65 GVGYD + GNP+GDP L DPG R +I+ +Y + +E + + P G++ R ++C Sbjct 243 GVGYDFIFGNPIGDPFLKVDPGYRDSIIKLTYPKSDEDYPDNYMNINPNGSFVRNEISCN 302 Query 66 QSENLSEVSSLADYQKELEADASLVGGDSVGL-NSFSASAAYRDIAKRTVKRNTKTFILK 124 +SE SE+S++++Y KEL DAS+ G S GL SFSAS Y+ ++ K + F+LK Sbjct 303 RSEKESEISTMSEYTKELSVDASI--GASYGLFGSFSASTGYKSVSNTISKNKFRMFMLK 360 Query 125 TYCLRFEAGLAQ------TDNF 140 +YC ++ A L+Q TD F Sbjct 361 SYCFKYVASLSQYSQWKLTDQF 382 Lambda K H 0.316 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40