bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1939_orf1 Length=105 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF0305c 145 2e-34 > 5833.PFF0305c Length=155 Score = 145 bits (367), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 61/105 (58%), Positives = 80/105 (76%), Gaps = 0/105 (0%) Query 1 WTAYIKGPKGSPYQGGRWKLQIICPPTYPLVPPQVVMQTKCFHPNIDFKTGAVCIDILRE 60 W A I+GPK SPY+GG+WKL I C TYP+ PP + TK FHPN++F TG +C+DIL+ Sbjct 33 WQAVIRGPKDSPYEGGKWKLNIKCKSTYPIDPPLITFVTKFFHPNVNFVTGELCMDILKA 92 Query 61 GWTPAWSLHFVCVALTSLLDSPNPDSPLNCDAGNLIRSGDLRGFR 105 W+PAW++ +C A+ L + PN DSPLNCDAGNLIRSGD++GF+ Sbjct 93 NWSPAWTIQSLCRAILFLFNEPNADSPLNCDAGNLIRSGDIKGFQ 137 Lambda K H 0.323 0.143 0.501 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682427107 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40