bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1919_orf2 Length=187 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0699 110 2e-23 > 5833.PF14_0699 Length=592 Score = 110 bits (275), Expect = 2e-23, Method: Composition-based stats. Identities = 51/122 (41%), Positives = 75/122 (61%), Gaps = 2/122 (1%) Query 68 VPFLRRLHWARLLRLLSGETLEDWAHQVQEQRQRYRSLRQQQQLSASQL--ATLDPQRFH 125 V RR++W LL + E LED + +Q++R Y +++ + L LDPQ FH Sbjct 77 VKLYRRIYWPLLLGIYKAENLEDLINDIQKKRHLYLQDKEEYIIKPINLNIQKLDPQIFH 136 Query 126 PLAATAGNPWSQRQADEELQEEIWRDIERTYPERQLFNKEGTRRSLQRVLFTWAKKNSDV 185 PL++ NPW+ +Q ++EL+EEI +DI RTY E+++F E R L +LF WAKKN D+ Sbjct 137 PLSSDDKNPWTLKQKNQELKEEIKQDILRTYSEKKIFQNEEIREILNTILFIWAKKNPDI 196 Query 186 SY 187 SY Sbjct 197 SY 198 Lambda K H 0.316 0.126 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40588496850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40