bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1851_orf2 Length=151 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000014485 95.1 5e-19 > 9031.ENSGALP00000014485 Length=596 Score = 95.1 bits (235), Expect = 5e-19, Method: Compositional matrix adjust. Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 29/150 (19%) Query 1 FATQTGNAQAAAADIWREAQRTLSLQQQPLLLPLAAAWPHLLQQQQQQQQQRQQQQQQQQ 60 F +QTG AQ A I REA+R + Q + + Sbjct 10 FGSQTGTAQDTAERIGREAKR-----------------------------RHFQCRVEAL 40 Query 61 QQDDLQRSPTKVVAIFVISTTGYGDVPDSMKTLWRGLLQQQLPPDYLSWLQFAVFGLGDR 120 D+ +++ +FV +TTG GD PD+MK WR L ++ LPP L + +AV GLGD Sbjct 41 DSYDVANLINELLVVFVCATTGQGDPPDNMKMFWRFLFRKNLPPTSLCQMDYAVLGLGDS 100 Query 121 RYVEFNFAAIKFYKRLQQLGAQPIVRLGLG 150 Y +FNF A K YKR+ QLG P++ + LG Sbjct 101 SYPKFNFIAKKLYKRVLQLGGNPLLPVALG 130 Lambda K H 0.322 0.133 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22675567716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40