bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1824_orf1 Length=114 Score E Sequences producing significant alignments: (Bits) Value 5671.LinJ10.0660 70.9 1e-11 > 5671.LinJ10.0660 Length=745 Score = 70.9 bits (172), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 40/106 (37%), Positives = 59/106 (55%), Gaps = 4/106 (3%) Query 1 YFCSASIIEEVASMWAFMPGCVLISRLCPKDIESTMYAVVAGLQNFAQSMSKLSGNFLCF 60 Y C +II + SM + MP +L+SRLCP+ ES +YA+++GL NF Q++S G+ L Sbjct 571 YLCGDAIIYNICSMLSTMPCTILMSRLCPRGSESMVYALMSGLSNFGQTVSTAVGSLLME 630 Query 61 TLLGIRTLATTEGTKCEFSNLPLAIGLAMGVCPFLPISLTFWLVPN 106 T R T C+FSN+ + CP L + L+F L+P Sbjct 631 T----RWPLDTNSVPCDFSNVRWLVVTGHLCCPLLIVPLSFLLLPR 672 Lambda K H 0.328 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22778399648 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40