bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1789_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000004613 91.3 8e-18 > 7719.ENSCINP00000004613 Length=295 Score = 91.3 bits (225), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 48/139 (34%), Positives = 81/139 (58%), Gaps = 7/139 (5%) Query 12 LQGLLGILSFVSLLAKRWRE--RPRRPWKVFLFDCSKQASGAFFIHMLNIGGAGLMAAVF 69 +Q +LG ++F +LL KRWRE RR WK++ +D SKQ GA FIH N+ L AV Sbjct 25 IQAILGAIAFSTLLLKRWREPRELRRTWKIWFYDTSKQGVGAAFIHFANV---FLADAVT 81 Query 70 EQDVCVWYWINIVVDTTLGVYVQYMLLQGARRLLK--GAACLEYGSYGSPPRWSACFAQA 127 +D C WY I+ ++D+T+G+ + Y+ + ++++ L +G YG+PP+ SA Q Sbjct 82 AEDPCTWYLISFLLDSTVGLLLIYLGFKLTQKIVHHFKIRSLYFGEYGNPPKISAFLGQT 141 Query 128 MSWQVFCLLMKIAASAFML 146 + + + ++ K+ +L Sbjct 142 ILYLIVMVIEKVLVGVMVL 160 Lambda K H 0.332 0.140 0.480 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40