bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1735_orf1 Length=127 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0649 110 8e-24 > 5833.PF14_0649 Length=2558 Score = 110 bits (276), Expect = 8e-24, Method: Composition-based stats. Identities = 49/123 (39%), Positives = 77/123 (62%), Gaps = 5/123 (4%) Query 3 RVCEAGVMLYFKQRLIRKLECTFPDAPKYIEASRYPPSERLFGQDGEPPQICRYAFTAVI 62 RVCE G++LY+K RLI++L+ F D + ++YPP+ L+ + + +YA T ++ Sbjct 2271 RVCETGILLYYKNRLIKRLDAPFIDTAYNLALAKYPPNPSLYEGN-----LYKYALTVIV 2325 Query 63 NVPEWMLPSLNKQEFLHENNKPYLKFKARCLKLMQEYLCRCRNQQALNAWLEQRAKRLSE 122 NVP W+ PS++KQEF+HENN +L FK + + L++ YL C++ L W E R +L Sbjct 2326 NVPYWLKPSISKQEFIHENNYAFLVFKKKLIGLIKHYLFICQDNVKLRKWRESRDLKLKR 2385 Query 123 YQD 125 Y D Sbjct 2386 YLD 2388 Lambda K H 0.323 0.137 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22506847341 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40