bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1729_orf1 Length=130 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1470 132 2e-30 > 5807.cgd4_1470 Length=920 Score = 132 bits (333), Expect = 2e-30, Method: Composition-based stats. Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 1/123 (0%) Query 1 FSFLQSIEQPFLDPKTGQHVHKSVFVVYHQGSTQSLLHEKIKKVADAFNGHCYEWPQTFR 60 F+ QSI + +DPKT + V K VFV+Y QG+T S +++KI ++ DAFN Y WP ++ Sbjct 237 FTHFQSIAENIMDPKTSKDVQKVVFVIYFQGATTSAVYDKISRICDAFNVSIYPWPSSYE 296 Query 61 AAEERLQALTEVIKDKEKALAAYEHYFLGEISTLLE-VPREGGSSLIEEWRVFCQKEKAI 119 A +R+ L +I+DKEKAL AYE Y EI TLL+ V G+SLIEEWR+FC KEK+I Sbjct 297 HAIQRISELNTLIQDKEKALQAYEQYITLEIETLLQPVNSNNGNSLIEEWRLFCIKEKSI 356 Query 120 YAS 122 YA+ Sbjct 357 YAT 359 Lambda K H 0.318 0.132 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40