bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1727_orf2 Length=152 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP012407-PA 155 4e-37 > 7165.AGAP012407-PA Length=472 Score = 155 bits (391), Expect = 4e-37, Method: Compositional matrix adjust. Identities = 79/150 (52%), Positives = 99/150 (66%), Gaps = 1/150 (0%) Query 1 AVLVMTKANFEDTLKQNEVVLVKFYAPWCGHCKRMAPEYAKAAKMLKDKNSKVILGKVDA 60 VLV+TK NF+ + NE VLV+FYAPWCGHCK +APEYAKAAK+L DK S + L KVDA Sbjct 28 GVLVLTKDNFDSVIANNEFVLVEFYAPWCGHCKALAPEYAKAAKVLADKESNIKLAKVDA 87 Query 61 TAEADLANKHEISEFPTVTLFRNQKPEQYTGGRTAEAIVDWVEMMTGPAVVEVSSEEEMK 120 T E +LA K+ I +PT+ FR+ YTGGR + IV W+E TGPA E+ + E Sbjct 88 TVEPELAEKYGIRGYPTLKFFRSGSQVDYTGGREQDTIVSWLEKKTGPAAKELET-VEAA 146 Query 121 EKITKESPVAFFGSFTSKDSELAKIFESVA 150 E+ KE+ VA G F +DS+ AK F S A Sbjct 147 EEFLKENNVAVVGFFKDRDSKEAKAFMSTA 176 Lambda K H 0.313 0.127 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40