bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1706_orf1 Length=114 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G18000.1 98.6 5e-20 > 3702.AT3G18000.1 Length=491 Score = 98.6 bits (244), Expect = 5e-20, Method: Composition-based stats. Identities = 46/84 (54%), Positives = 61/84 (72%), Gaps = 0/84 (0%) Query 30 QEALDSRQYSKNGILRYEFVFGRGFVSSGGGDTTAEILEHISLPKSGKAIDVGCGIGGSS 89 Q LD+ QY +GILRYE VFG+GFVS+GG +TT E +E ++L K +DVGCGIGG Sbjct 238 QRFLDNVQYKSSGILRYERVFGQGFVSTGGLETTKEFVEKMNLKPGQKVLDVGCGIGGGD 297 Query 90 AALADRFSANVLGVDLSANMISIA 113 +A++F +V+G+DLS NMIS A Sbjct 298 FYMAEKFDVHVVGIDLSVNMISFA 321 Lambda K H 0.314 0.130 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22778399648 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40