bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1689_orf1 Length=80 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL2110c 64.3 1e-09 > 5833.PFL2110c Length=1846 Score = 64.3 bits (155), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 31/81 (38%), Positives = 51/81 (62%), Gaps = 1/81 (1%) Query 1 NEKHQKKPQVQKERLILETNMKTKYEARVFSGTKRLSFIHKDDRPSNLSFEAWTCPDLL- 59 NEK+ ++ + + E + LETN+K Y+ V+ G K+L F+H D R SN+ F WT PD+L Sbjct 615 NEKNVRRNKTKLEHIDLETNVKITYDTVVYRGCKKLCFLHDDQRMSNIHFSIWTYPDILG 674 Query 60 DASDLEKLPQAERFDTKNNMP 80 ++++ +K+ F+T N P Sbjct 675 NSTNQKKIVAPVSFNTTMNFP 695 Lambda K H 0.313 0.129 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22875389805 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40