bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1586_orf2 Length=154 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0231973 132 3e-30 > 44689.DDB_0231973 Length=2473 Score = 132 bits (333), Expect = 3e-30, Method: Composition-based stats. Identities = 59/123 (47%), Positives = 80/123 (65%), Gaps = 0/123 (0%) Query 30 EIPAEFLGRPNEFFTKGAHVNYGADFGLMPSAFEPGGIVQHEFFISGTPVIAFHTGGLKD 89 + P F P+ FF+ G VN G+DFGLMPS FEP G+VQ E+F++GTPVIAF TGGLKD Sbjct 2298 QFPQSFWADPDSFFSDGPLVNLGSDFGLMPSLFEPSGVVQQEYFVAGTPVIAFKTGGLKD 2357 Query 90 TVVEFVPAAGTGNGFSFMNYTSGDLLYAMERAIRVFDDKEKYTLLRQLARQSVVSCECSS 149 TV E+ TGNGF+F + D + A+ RAI +F++ Y +R+ A +SV+ + Sbjct 2358 TVFEYNTNTETGNGFTFEAHKHTDYVQAVHRAINIFNNTHHYEKIRKCAEESVLDMSVVA 2417 Query 150 WAW 152 AW Sbjct 2418 EAW 2420 Lambda K H 0.323 0.139 0.446 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23121682173 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40