bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1583_orf1 Length=165 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000028215 150 1e-35 > 7955.ENSDARP00000028215 Length=648 Score = 150 bits (379), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 76/166 (45%), Positives = 117/166 (70%), Gaps = 7/166 (4%) Query 2 RVKECAQKFSAFVNFPVYMEDNGKEVQVSSQEALWLKTSATPEE--HKQFFRHLTNQSWG 59 RVKE K+S FV+FP+++ NG+ ++++ +ALW+ E H++F+R++ Q++ Sbjct 213 RVKEVVTKYSNFVSFPIFL--NGR--RLNTLQALWMMEPKDISEWQHEEFYRYVA-QAYD 267 Query 60 EPFYSIMFSADAPLSIRSVLYFPADPPNRLFQTGPLESGVSLLSRPVLVKKSATDLLPKW 119 +P Y++ + ADAPL+IRS+ Y P P+ + + S V+L SR VL++ ATD+LPKW Sbjct 268 KPRYTLHYRADAPLNIRSIFYVPEMKPSMFDVSREMGSSVALYSRKVLIQTKATDILPKW 327 Query 120 LWFLRGIVDCEDLPLNVSREHMQDSALQRKLSSVIVRRILRFLNDQ 165 L FLRG+VD ED+PLN+SRE +Q+SAL RKL V+ +R++RFL DQ Sbjct 328 LRFLRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRVIRFLLDQ 373 Lambda K H 0.321 0.135 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 29254071491 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40