bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1570_orf1 Length=128 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G74250.1 71.2 8e-12 > 3702.AT1G74250.1 Length=630 Score = 71.2 bits (173), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 34/76 (44%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Query 2 WGDVGPFYSYWHSFTSVRDFAEVDQWSPKDMAEASRAERRLMERDNGRKRKEAKKEFVDT 61 + V FY+YW F +V DF VD++ M +R RR+ME +N + RK+AK+E+ DT Sbjct 165 YAQVTAFYNYWLGFCTVMDFCWVDEYDV--MGGPNRKSRRMMEEENKKSRKKAKREYNDT 222 Query 62 VRRLAQHIKKKDPRVL 77 VR LA+ +KK+D RV+ Sbjct 223 VRGLAEFVKKRDKRVI 238 Lambda K H 0.317 0.128 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22424899233 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40