bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1557_orf1 Length=155 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G09270.1 228 4e-59 > 3702.AT1G09270.1 Length=538 Score = 228 bits (581), Expect = 4e-59, Method: Compositional matrix adjust. Identities = 113/155 (72%), Positives = 126/155 (81%), Gaps = 1/155 (0%) Query 1 MHSSKEEVREQAVWALGNIAGDSPDCRNLVLDSGALPPLLEQLNTPGSKLPMIRNATWTL 60 + S+ ++VREQAVWALGN+AGDSP+CRNLVL+ GAL PLL QLN SKL M+RNATWTL Sbjct 174 LTSASDDVREQAVWALGNVAGDSPNCRNLVLNYGALEPLLAQLNE-NSKLSMLRNATWTL 232 Query 61 SNLCRGKPAPAFEKVSPALPTLAALIYSDDAEVLTDACWALSYLSDGPNDRIGAVLEAGV 120 SN CRGKP FE+V PALP L LIY +D EVLTDACWALSYLSDGPND+I AV+EAGV Sbjct 233 SNFCRGKPPTPFEQVKPALPILRQLIYLNDEEVLTDACWALSYLSDGPNDKIQAVIEAGV 292 Query 121 CARLVDLLMHPSTLVQTPALRAVGNIVTGDDRQTQ 155 C RLV+LL H S V PALR VGNIVTGDD QTQ Sbjct 293 CPRLVELLGHQSPTVLIPALRTVGNIVTGDDSQTQ 327 Lambda K H 0.316 0.133 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23746592502 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40