bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1547_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0520c 151 6e-36 > 5833.PFE0520c Length=839 Score = 151 bits (381), Expect = 6e-36, Method: Compositional matrix adjust. Identities = 78/149 (52%), Positives = 109/149 (73%), Gaps = 1/149 (0%) Query 4 LNVDISDVNQLVQFYNDANRAVAILCNHQRSIPKQHAASMARLQHQLSAIEEDLRECEEF 63 + VD+S++N+L+ FYN+ANR VAILCNHQRSIPKQH +M++++ Q+ ED++E +++ Sbjct 664 IEVDVSNINELINFYNNANREVAILCNHQRSIPKQHDTTMSKIKKQIELYNEDIKEYKKY 723 Query 64 LAFCKKDKQQKQFKFKSDFKTLKGEPRKSVVREGMKEDAVLKKIAQLKKKKQTHLLRMHI 123 L KK+ K+F F S TL G R + V+E MKE++ KK+ L KK + +M + Sbjct 724 LQHLKKN-SDKKFIFVSKVSTLDGTLRPNKVKENMKEESCKKKLITLIKKVELLNNQMKV 782 Query 124 KDSNKTVALGTSKINYMDPRITVAFCKKY 152 +D NKT+ALGTSKINYMDPRITVAFCKK+ Sbjct 783 RDDNKTIALGTSKINYMDPRITVAFCKKF 811 Lambda K H 0.319 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40