bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1529_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_1180 139 4e-32 > 5807.cgd1_1180 Length=877 Score = 139 bits (349), Expect = 4e-32, Method: Composition-based stats. Identities = 75/129 (58%), Positives = 88/129 (68%), Gaps = 15/129 (11%) Query 2 GHHPGCSEESLRKTLGIRMKRSACFLTNTKQ--FKSPPPLSAAAAPEVPAGEP------- 52 GH PG S ES + TLG+R+ R + + + KQ FK PP A P GEP Sbjct 56 GHVPGVSLESRKMTLGVRIPRDSTYCNSIKQPGFKLPP----KADDSSPKGEPEPQVNVN 111 Query 53 -LILYEPKEVGERKV-EVGPMLTRWLREHQREGVRFIFECLMGLKEFDGCGCILADDMGL 110 LIL+ E GE++V EV MLT+WLREHQR+GV FIFECLMGL++FDG GCILADDMGL Sbjct 112 PLILWISSEDGEKRVIEVDSMLTKWLREHQRQGVTFIFECLMGLRDFDGNGCILADDMGL 171 Query 111 GKTLQSITI 119 GKTLQSITI Sbjct 172 GKTLQSITI 180 Lambda K H 0.320 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22381075488 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40