bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1508_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1470 83.6 1e-15 > 5807.cgd4_1470 Length=920 Score = 83.6 bits (205), Expect = 1e-15, Method: Composition-based stats. Identities = 42/101 (41%), Positives = 64/101 (63%), Gaps = 2/101 (1%) Query 16 SASRRLLSAGGLGGLES-GEMSSLVFSSVAGIVAAKDQERFARAMFRSTRGNAFTHFKRL 74 + S L++ G + G+ + ++FSS+AG+V +DQE+FARA+FR+TRGN FTHF+ + Sbjct 184 TPSSPLMNPGIMDGINNVSGFGDMMFSSIAGVVKHEDQEKFARALFRATRGNTFTHFQSI 243 Query 75 EEEELTAYPHGEEPKSLFVTYFQGAATGSAFMEKVKCVCSA 115 E + + K +FV YFQGA T SA +K+ +C A Sbjct 244 AENIMDPKTSKDVQKVVFVIYFQGATT-SAVYDKISRICDA 283 Lambda K H 0.317 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22381075488 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40