bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1480_orf1 Length=95 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_3720 74.7 7e-13 > 5807.cgd8_3720 Length=475 Score = 74.7 bits (182), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 43/104 (41%), Positives = 58/104 (55%), Gaps = 10/104 (9%) Query 2 GHHIKNCPKSSDAKQQKKIRPATGLPSSFLRDI-LPSEIHKYQEVYIKKDGSFAVLKTA- 59 GHHI+ CPK ++ QKKIRPATG+P SFLR I E Y EVY DG+FAVLK A Sbjct 301 GHHIRVCPKVNEGVSQKKIRPATGIPRSFLRAINFDEEGRLYSEVYCLPDGTFAVLKDAK 360 Query 60 AIGGLSLLGSSLDMRIQRHVGGAAH--------LKCGCCNSIFK 95 + + L +++ I +H+G + L C C +F+ Sbjct 361 QLSSTAFLTRTVEDTIGKHMGKSKEDTSLVRDSLTCPICARLFR 404 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22621220430 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40