bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1453_orf1 Length=115 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G33340.1 87.0 2e-16 > 3702.AT2G33340.1 Length=565 Score = 87.0 bits (214), Expect = 2e-16, Method: Composition-based stats. Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 4/114 (3%) Query 1 LVISGSDDKTVKIWRGSNDFSSSFTLGVALRRQRGDICGLALHPLNDYFAAAAADSTWSF 60 LV++ S DKTV+IWR D ++ G L ++ + +HP N YF +A+ D TW F Sbjct 278 LVLTASADKTVRIWRNPGD--GNYACGYTLNDHSAEVRAVTVHPTNKYFVSASLDGTWCF 335 Query 61 IGIKEGRYLSVYKDLSSQ--YSSLAFHPDGMIMGGGGVDGNIYIWDMKGQQQRA 112 + G L+ D S Y++ AFHPDG+I+G G + IWD+K Q A Sbjct 336 YDLSSGSCLAQVSDDSKNVDYTAAAFHPDGLILGTGTSQSVVKIWDVKSQANVA 389 Lambda K H 0.320 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22698934816 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40