bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1424_orf1 Length=99 Score E Sequences producing significant alignments: (Bits) Value 317655.Sala_2230 114 8e-25 > 317655.Sala_2230 Length=320 Score = 114 bits (285), Expect = 8e-25, Method: Compositional matrix adjust. Identities = 55/98 (56%), Positives = 71/98 (72%), Gaps = 0/98 (0%) Query 1 EIVRLLGQGSAYYAPGASAIQMAESYLKDRKRVMVCSCYLQGQYGVQNHYLGVPCVIGGR 60 EIV LLG GSA+YAP AS I MAE+YL D+KR++ C+ Y+ GQYGV Y+GVP +IG Sbjct 221 EIVALLGTGSAFYAPAASGIAMAEAYLGDQKRILPCAAYVDGQYGVDGLYVGVPVMIGAG 280 Query 61 GVEKIIELELTAQERQELQGSIDEVKEMQKAIAALDAS 98 GVEKI+E+EL ++ LQ S+D VKE+ +A LD S Sbjct 281 GVEKIVEIELDDADKAGLQVSVDAVKELLEACKKLDPS 318 Lambda K H 0.317 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23144316443 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40