bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1415_orf1 Length=160 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0108 115 5e-25 > 5833.PF11_0108 Length=1329 Score = 115 bits (288), Expect = 5e-25, Method: Composition-based stats. Identities = 75/146 (51%), Positives = 95/146 (65%), Gaps = 10/146 (6%) Query 2 RRRSRREARLKEEIAKLRAEKPTIHQQFADLKMGLTSVTQEEWESIPDIGDYTLKRKQKK 61 RR+SRRE +LKEEI+K+RA KPTI QQF DLK L +VT EEWESIP + Y+ K+KQKK Sbjct 112 RRKSRRENKLKEEISKMRATKPTITQQFGDLKKNLANVTIEEWESIPTVLQYSSKQKQKK 171 Query 62 QQM-LTPASDRGILEARNRE----SFSNSIAS-AGSATPIGFGMATPLMAGGLSTPLGLQ 115 Q PA D I+ N +F+NS +S +G TPIG G + L G+ TPLGL+ Sbjct 172 VQKNYLPAPDSLIMSRINESNIHLNFNNSASSQSGHKTPIGLGYQSSL---GVQTPLGLR 228 Query 116 TPLGIQTPL-GLRTPMGSSTPSLNDL 140 TP G+Q L GL+TP+ SL+ L Sbjct 229 TPYGLQNSLSGLKTPLSGLQNSLSGL 254 Lambda K H 0.312 0.130 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26871144147 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40